DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG13527

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:270 Identity:65/270 - (24%)
Similarity:108/270 - (40%) Gaps:67/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LKTPKFR--------RVWGGVQSNTGPN--FGGWLLRILNGDGNFACGAAYYAPLLVITSANCIY 86
            |.:|||.        :....::|.| ||  ||          .|..||....:...|||:|:|:.
  Fly    27 LSSPKFHGDETLELAKYVVSIRSRT-PNKYFG----------DNHYCGGGLLSNQWVITAAHCVM 80

  Fly    87 PYRNSLEGA----TVEGTAF--------SECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLR-- 137
            .....:..|    .|.|:..        |.|     :.:.::..|:.|.....: ::|:::|:  
  Fly    81 GQSKIMYKARWLLVVAGSPHRLRYTPGKSVC-----SPVSSLYVPKNFTMHNTF-NMALMKLQEK 139

  Fly   138 ----DPVRGRLTEFIRLCSVKVQPK--MQMVVFGWG---FDN-TEVEIPSSDPRNVTVTIISIKE 192
                ||..|    |:.|  .|..||  ::..|.|||   |.. ..|.|     ..|.|.::....
  Fly   140 MPSNDPRIG----FLHL--PKEAPKIGIRHTVLGWGRMYFGGPLAVHI-----YQVDVVLMDNAV 193

  Fly   193 CRQKFKSPKIASTSICARQPK---NPKQCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNI 254
            |:..|:  ......:||....   :.:.|..|.||||:.|:.:.|:|::...|..|:.|.:||::
  Fly   194 CKTYFR--HYGDGMMCAGNNNWTIDAEPCSGDIGSPLLSGKVVVGIVAYPIGCGCTNIPSVYTDV 256

  Fly   255 RRVKRFITET 264
            ....|:|..|
  Fly   257 FSGLRWIRHT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 59/250 (24%)
Tryp_SPc 55..261 CDD:304450 53/232 (23%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 60/252 (24%)
Tryp_SPc 43..263 CDD:214473 59/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.