DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and tpr

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:272 Identity:72/272 - (26%)
Similarity:115/272 - (42%) Gaps:50/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RRVWGGVQSNTG--PNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGT 100
            :|:.||.::...  |    |:..:|.| |.|.|.|:......::|:::|:|.:|.  |..:|.  
  Fly   125 KRIVGGQETEVHQYP----WVAMLLYG-GRFYCAASLLNDQFLLTASHCVYGFRK--ERISVR-- 180

  Fly   101 AFSECDRE--NYADID-----TIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQPK 158
             ..|.||:  :...||     .|..| |:..:....|:|:::|.:||     ||..:......|.
  Fly   181 -LLEHDRKMSHMQKIDRKVAEVITHP-KYNARNYDNDIAIIKLDEPV-----EFNEVLHPVCMPT 238

  Fly   159 -------MQMVVFGWGFDNTEVEIPSSDP-RNVTVTIISIKECRQKFKSPKIASTSICARQPKNP 215
                   ...:|.|||  ..:|..|:||. :.|.|.|:|..|||:.....||....:|....:..
  Fly   239 PGRSFKGENGIVTGWG--ALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGG 301

  Fly   216 K-QCLYDGGSPL------IYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITETEESINAGDV 273
            | .|..|.|.||      ....::.||||:|..|.....||:|..:.|...:|....:       
  Fly   302 KDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTK------- 359

  Fly   274 FRSTKVVKETKK 285
             ::....:||||
  Fly   360 -QACLCQQETKK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 67/245 (27%)
Tryp_SPc 55..261 CDD:304450 63/227 (28%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 67/245 (27%)
Tryp_SPc 127..356 CDD:238113 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.