DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG11192

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:247 Identity:62/247 - (25%)
Similarity:104/247 - (42%) Gaps:53/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RILNGD----------------GNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECD 106
            ||:.|:                |...||.|......|:|:|:|.....:|.:.....|::    :
  Fly    27 RIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSS----E 87

  Fly   107 RENYADIDTIQFPEKFIYQKLY------MDVAVVRLRDPVRGRL--TEFIR---LCSVKVQP--K 158
            .|:...:.:::   :.|....|      .|:|::.|    .|:|  ||.::   |.::...|  .
  Fly    88 HESGGHVLSLR---RVIAHGDYNPQSHDNDLALLIL----NGQLNFTEHLQPVPLAALADPPTAD 145

  Fly   159 MQMVVFGWGFDNTEVEIP-----SSDPRNVTVTIISIKECRQKFKSP-KIASTSICARQPKNPKQ 217
            .::.|.||||...|..:.     |...|.|.|.::...:||:.:... .|....|||.:| ....
  Fly   146 TRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAARP-GRDS 209

  Fly   218 CLYDGGSPLI-YGRE-----LCGVVSFGSHCIDTSRPGMYTNIRRVKRFITE 263
            |..|.|.||: |..|     |.|:||:|..|.:.:.||:|||:...:.:|.|
  Fly   210 CQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDE 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 60/243 (25%)
Tryp_SPc 55..261 CDD:304450 60/243 (25%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 60/243 (25%)
Tryp_SPc 28..262 CDD:238113 61/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.