DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Prss3

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:246 Identity:61/246 - (24%)
Similarity:104/246 - (42%) Gaps:46/246 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVWGG--VQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYR----------NS 91
            ::.||  .|.|:.|      .::....|...||.:......|:::|:| |..|          |.
  Rat    23 KIVGGYTCQENSVP------YQVSLNSGYHFCGGSLINDQWVVSAAHC-YKTRIQVRLGEHNINV 80

  Fly    92 LEGATVEGTAFSECDRE--NYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVR--GRLTEFIRLCS 152
            |||           |.:  |.|.|  |:.| .|..:.|..|:.:::|..||:  .|:.. :.|.|
  Rat    81 LEG-----------DEQFVNAAKI--IKHP-NFNARNLNNDIMLIKLSSPVKLNARVAT-VALPS 130

  Fly   153 VKVQPKMQMVVFGWGFDNTEVEIPSSDP---RNVTVTIISIKECRQKFKSPKIASTSICARQPKN 214
            .......|.::.|||  || :.:..::|   :.:...::...:|...:.. ||.:..||....:.
  Rat   131 SCAPAGTQCLISGWG--NT-LSLGVNNPDLLQCLDAPVLPQADCEASYPG-KITNNMICVGFLEG 191

  Fly   215 PK-QCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITET 264
            .| .|..|.|.|::...:|.|:||:|..|.....||:||.:.....:|.:|
  Rat   192 GKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 59/241 (24%)
Tryp_SPc 55..261 CDD:304450 54/223 (24%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 59/241 (24%)
Tryp_SPc 24..242 CDD:238113 60/243 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.