DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and gammaTry

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:272 Identity:71/272 - (26%)
Similarity:117/272 - (43%) Gaps:53/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VSCLLWTCLPQSQGTVYPRDILLKTPKF-RRVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYY 73
            |:|.|       .||| |..:|   |:. .|:.|| .:.|..:| .|.:. |...|:.:||.:.|
  Fly    11 VACAL-------GGTV-PEGLL---PQLDGRIVGG-SATTISSF-PWQIS-LQRSGSHSCGGSIY 61

  Fly    74 APLLVITSANCIYPYRNSLEGATVE-----------GTAFSECDRENYADIDTIQFPEKFIYQKL 127
            :..:::|:|:|:    .|:..:.::           |..||....:|:         |.:....:
  Fly    62 SSNVIVTAAHCL----QSVSASVLQIRAGSSYWSSGGVTFSVSSFKNH---------EGYNANTM 113

  Fly   128 YMDVAVVRLRDPVRGRLT-----EFIRLCSVKVQPKMQMVVFGWG-FDNTEVEIPSSDPRNVTVT 186
            ..|:|:::    :.|.||     :.|.|.|..........|.||| .......|| |..:.|.|.
  Fly   114 VNDIAIIK----INGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIP-SQLQYVNVN 173

  Fly   187 IISIKECRQKF--KSPKIASTSICARQPKNPKQCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPG 249
            |:|..:|....  ...:|.||.||| .......|..|.|.||:.|..|.||||:|..|..::.||
  Fly   174 IVSQSQCASSTYGYGSQIRSTMICA-AASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPG 237

  Fly   250 MYTNIRRVKRFI 261
            :|.::..::.::
  Fly   238 VYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 62/240 (26%)
Tryp_SPc 55..261 CDD:304450 57/224 (25%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 62/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.