DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and thetaTry

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:262 Identity:60/262 - (22%)
Similarity:113/262 - (43%) Gaps:37/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQGTVYPRDILLKTPKFRRVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCI 85
            |.|..:.|:        .|:.||..:..|.:  .:.:.:....|:..||.:......|:|:|:|:
  Fly    24 SNGDPFERE--------GRIVGGEDTTIGAH--PYQVSLQTKSGSHFCGGSLINEDTVVTAAHCL 78

  Fly    86 YPYRNSLEGATVEGTAFSE-----CDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLT 145
            ...:.|.....:..|.::|     ..||       :.:.|.:..:.:..||.:::|.:.|:.  |
  Fly    79 VGRKVSKVFVRLGSTLYNEGGIVVAVRE-------LAYNEDYNSKTMEYDVGILKLDEKVKE--T 134

  Fly   146 EFIRLCSVKVQPK---MQMVVFGWGFDNTE-----VEIPSSDPRNVTVTIISIKEC-RQKFKSPK 201
            |.||...:..:..   ...||.|||   ::     :.:|.: .:.|.|.|:..|.| ..::|..:
  Fly   135 ENIRYIELATETPPTGTTAVVTGWG---SKCYFWCMTLPKT-LQEVYVNIVDWKTCASDEYKYGE 195

  Fly   202 IASTSICARQPKNPKQCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITETEE 266
            |...|:.....|....|..|.|.||..|..|.|:||:|..|.....||:|:::..::::|....|
  Fly   196 IIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWILNASE 260

  Fly   267 SI 268
            ::
  Fly   261 TL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 55/235 (23%)
Tryp_SPc 55..261 CDD:304450 51/219 (23%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 55/235 (23%)
Tryp_SPc 35..255 CDD:238113 54/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.