DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG8172

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:276 Identity:78/276 - (28%)
Similarity:116/276 - (42%) Gaps:49/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GTVYPRDILLKTPKFRRVWGGVQSNTGPNFGG--WLLRILNG---DGNFACGAAYYAPLLVITSA 82
            |.||.|.        .|:.||  .:||  ||.  |.:.::..   ....:||.|..:...|||:|
  Fly   307 GEVYTRS--------NRIVGG--HSTG--FGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAA 359

  Fly    83 NCIYPYRNS-----LEGATVEGTAFSECDRENYA----DIDTIQFPEKFIYQKLYMDVAVVRL-R 137
            :|:....||     |....|.|.. ...:.|.|.    ::.....|..|:     .|||::|| |
  Fly   360 HCVASTPNSNMKIRLGEWDVRGQE-ERLNHEEYGIERKEVHPHYNPADFV-----NDVALIRLDR 418

  Fly   138 DPVRGRLTEFIRLC----SVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFK 198
            :.|..:  ..|.:|    :.|:..||..|. |||..........|..:.|.|.:||...|::.|:
  Fly   419 NVVYKQ--HIIPVCLPPSTTKLTGKMATVA-GWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFR 480

  Fly   199 S----PKIASTSICARQPKNPK-QCLYDGGSPL---IYGRE-LCGVVSFGSHCIDTSRPGMYTNI 254
            :    ..|....:||......: .|..|.|.||   :.||: |.|:||:|..|.....||:||||
  Fly   481 AAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNI 545

  Fly   255 RRVKRFITETEESINA 270
            :|...:|.:...:.||
  Fly   546 QRFVPWINKVMANDNA 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 71/249 (29%)
Tryp_SPc 55..261 CDD:304450 64/231 (28%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 71/249 (29%)
Tryp_SPc 316..555 CDD:238113 71/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.