DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Send2

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:260 Identity:60/260 - (23%)
Similarity:95/260 - (36%) Gaps:73/260 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFS 103
            |:.||  ...|.....|.:.| ..||...||.:.|:..::||:|:|:       :|...:..|.|
  Fly    26 RIIGG--QPIGIEEAPWQVSI-QRDGKHLCGGSIYSADIIITAAHCV-------QGQGYQVRAGS 80

  Fly   104 ECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEF------IRLCSVKVQPKMQMV 162
            .....|.:.:|.....   .::.|..|:|:|||..|:     ||      |.|......|.....
  Fly    81 ALKNSNGSVVDVAAIR---THEGLGNDIAIVRLSKPL-----EFTNQVQPIPLAKTNPPPGSIAF 137

  Fly   163 VFGWGFD------------NTEVEIP----SSDPRNVTVTIISIKECRQKFKSPKIASTSICARQ 211
            |.|||..            |..::.|    .::|..:         |...|              
  Fly   138 VSGWGSSSYYSHPIDLQGVNLYIQWPYYCGLTEPSRI---------CAGSF-------------- 179

  Fly   212 PKNPKQCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITETEESINAGDVFRS 276
              ....|..|.|.||::.::|.||||.|:.  |.:...:||::...:.:|      :||.|...|
  Fly   180 --GRAACKGDSGGPLVFDQQLVGVVSGGTK--DCTYSSIYTSVPYFREWI------LNAIDEIMS 234

  Fly   277  276
              Fly   235  234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 55/243 (23%)
Tryp_SPc 55..261 CDD:304450 51/227 (22%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 55/243 (23%)
Tryp_SPc 27..225 CDD:238113 54/242 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.