DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Phae2

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:295 Identity:75/295 - (25%)
Similarity:117/295 - (39%) Gaps:76/295 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IW----LLVSCLLWTCLPQSQGTVYPRDILLKTPKFRRVWG-GVQSNTGPNFGGWLLRILNGDGN 65
            :|    |....||..|:.|..|      :.|..|:.|.|.| ...:|:.|    :::.:..| |.
  Fly     1 MWRHRHLATILLLAVCVSQGSG------LALDQPEGRVVGGKAAAANSAP----YIVSMQYG-GT 54

  Fly    66 FACGAAYYAPLLVITSANCIYPYRNSLEGAT-------VEGTAFSECDRE--NYA---------- 111
            ..|.|.......::|:|:|: ..||.:.|:|       |.|||.:...|:  :|.          
  Fly    55 HYCAANIINSNWLVTAAHCL-ANRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTV 118

  Fly   112 --DIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVE 174
              ||..|..|..|.:     ..||..::.|..|            |:|..:..:|||| ..::..
  Fly   119 PYDIGLIYTPTAFTW-----TAAVAPVKLPSSG------------VRPTGKADLFGWG-STSKTN 165

  Fly   175 IPSSDPRNV----TVTIISIKECRQKF--KSPKIASTSICARQPKNP-----KQCLYDGGSPLIY 228
            .||. |:.:    .:.|||:..|....  |...:.:|::|.    .|     ..|..|.|.||:.
  Fly   166 SPSY-PKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCT----GPLTGGTSFCTSDSGGPLVQ 225

  Fly   229 GRELCGVVSFGS-HCIDTSRPGMYTNIRRVKRFIT 262
            |..|.|:||:|. .|...:.|.:|.   :|..|||
  Fly   226 GNVLIGIVSWGKLPCGQPNSPSVYV---QVSSFIT 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 62/255 (24%)
Tryp_SPc 55..261 CDD:304450 58/238 (24%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 66/259 (25%)
Tryp_SPc 32..262 CDD:238113 65/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.