DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CFI

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001362207.1 Gene:CFI / 3426 HGNCID:5394 Length:601 Species:Homo sapiens


Alignment Length:153 Identity:38/153 - (24%)
Similarity:61/153 - (39%) Gaps:26/153 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RRVWGGVQSNTG--PNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCI---YPYRNSLEGATV 97
            :|:.||.::..|  |    |.:.|.:..| ..||..|.....::|:|:|:   ..:|..: ..||
Human   346 KRIVGGKRAQLGDLP----WQVAIKDASG-ITCGGIYIGGCWILTAAHCLRASKTHRYQI-WTTV 404

  Fly    98 EGTAFSECDRENYADIDTIQFPEKF---IYQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKV---- 155
            ......:..|.....:|.|.|.|.:   .||.   |:|::.::.....:..|..|.....|    
Human   405 VDWIHPDLKRIVIEYVDRIIFHENYNAGTYQN---DIALIEMKKDGNKKDCELPRSIPACVPWSP 466

  Fly   156 ---QPKMQMVVFGWG--FDNTEV 173
               ||....:|.|||  .||..|
Human   467 YLFQPNDTCIVSGWGREKDNERV 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 38/152 (25%)
Tryp_SPc 55..261 CDD:304450 33/134 (25%)
CFINP_001362207.1 FIMAC 43..108 CDD:214493
SR 114..215 CDD:214555
LDLa 224..256 CDD:238060
Ldl_recept_a 257..293 CDD:365841
Tryp_SPc 348..>519 CDD:238113 37/151 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.