DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and PRSS53

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:319 Identity:64/319 - (20%)
Similarity:99/319 - (31%) Gaps:113/319 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFS----EC 105
            :.||.|....|...: ...|...|..:..|...|:|:|:|..      :.|..|..::|    ..
Human    40 EGNTVPGEWPWQASV-RRQGAHICSGSLVADTWVLTAAHCFE------KAAATELNSWSVVLGSL 97

  Fly   106 DRENYA------DIDTIQFPEKFIYQKLYMDVAVVRLRDPV------------------------ 140
            .||..:      .:..:|.|..:.:.....|:|:::|..|.                        
Human    98 QREGLSPGAEEVGVAALQLPRAYNHYSQGSDLALLQLAHPTTHTPLCLPQPAHRFPFGASCWATG 162

  Fly   141 ------------RGRLTEFIRLCSVKVQ------------PKMQMVVFGWGFDNTEVEIPSSDP- 180
                        |.:|.|.:.|.||.|.            |:.|          |....||..| 
Human   163 WDQDTSDGKCWPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQ----------TLAPAPSLSPA 217

  Fly   181 ----RNVTVTIISIKEC-------RQKFKSPKIASTSIC-ARQPKNPKQCLYDGGSPLIYGRELC 233
                ||:.:.:||...|       .|:..|.......:| ..||.....|..|.|.|:     ||
Human   218 PGTLRNLRLRLISRPTCNCIYNQLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPV-----LC 277

  Fly   234 ----------GVVSFGSHCIDTSRPGMYTNI--------RRVK--RFITETEESINAGD 272
                      |::||.|.|.....|.:.||.        .||:  .|:.::.|:....|
Human   278 LEPDGHWVQAGIISFASSCAQEDAPVLLTNTAAHSSWLQARVQGAAFLAQSPETPEMSD 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 61/306 (20%)
Tryp_SPc 55..261 CDD:304450 58/296 (20%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 59/295 (20%)
Tryp_SPc 43..314 CDD:214473 58/292 (20%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.