DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG3355

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:247 Identity:74/247 - (29%)
Similarity:112/247 - (45%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TPKFRRVWGG--VQSNTGPNFGGWLLRILNGD--GNFACGAAYYAPLLVITSANCIYPYRNSLEG 94
            ||...|:.||  |:||..|    |..:::.|.  ....||.:......|:|:|:|::..|:.:  
  Fly    70 TPNVNRIVGGQQVRSNKYP----WTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQI-- 128

  Fly    95 ATVEGTAFSECDRENYAD------IDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIR-LCS 152
             |:.   ..:.||.:...      :.|...| .:...::..|||:::|..||  .||..:| :|.
  Fly   129 -TIR---LLQIDRSSRDPGIVRKVVQTTVHP-NYDPNRIVNDVALLKLESPV--PLTGNMRPVCL 186

  Fly   153 VKVQPKMQ---MVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICAR--QP 212
            .:......   .||.|||... |..:.|:..:.|.|.:|:..:|||.....|||...:||.  |.
  Fly   187 PEANHNFDGKTAVVAGWGLIK-EGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQ 250

  Fly   213 KNPKQCLYDGGSPLIY--GR-ELCGVVSFGSHCIDTSRPGMYTNIRRVKRFI 261
            .....|..|.|.|||.  || :|.||||||..|...:.||:|.   ||.:|:
  Fly   251 GGKDACQGDSGGPLIVNEGRYKLAGVVSFGYGCAQKNAPGVYA---RVSKFL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 71/240 (30%)
Tryp_SPc 55..261 CDD:304450 64/222 (29%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 72/242 (30%)
Tryp_SPc 76..305 CDD:238113 71/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.