DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG4271

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:249 Identity:58/249 - (23%)
Similarity:90/249 - (36%) Gaps:39/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FRRVWGGVQSNTGPNFGGW-LLRILNGDGNFACGAAYYAPLLVITSANCIYP------------- 87
            |.|...|:.:.....|..| .|..:...|...||.|.....:|:|:|.|:..             
  Fly    12 FARSSNGIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTP 76

  Fly    88 --YRNSLEGATVEGTAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRG-RLTEFIR 149
              ||.   |..:..||.  ...|||.:.|.              |:|::.|..||.. |:|: |.
  Fly    77 DIYRG---GRIIRVTAL--VVHENYKNWDN--------------DIALLWLEKPVLSVRVTK-IP 121

  Fly   150 LCSVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKN 214
            |.:.:..........|||....|..:.:...:|....|.....|.::...| :....:||...:|
  Fly   122 LATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEELVEP-VGEELLCAFYTEN 185

  Fly   215 PKQCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITETEESI 268
             ..|..|.|.||:...::.|:...|..|.....|.:|||:.....:|.|..|.:
  Fly   186 -DICPGDYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTNVFHYLEWIEENAEKL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 54/238 (23%)
Tryp_SPc 55..261 CDD:304450 51/222 (23%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 53/236 (22%)
Tryp_SPc 19..231 CDD:214473 52/233 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.