DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG11911

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:225 Identity:53/225 - (23%)
Similarity:92/225 - (40%) Gaps:42/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGAAYYAPLLVITSANCI-YPYRNSL------EGATVEGTAFSECD----RENYA------DIDT 115
            ||........::|:|:|| .|...|:      .....|.|...:.|    .|.|.      ||..
  Fly    65 CGGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIAL 129

  Fly   116 IQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDP 180
            :...|.||:.: ::..|.:..|:.|....|.                ::|||...:.:...:...
  Fly   130 LHVNESFIFNE-WVQPATLPSREQVHEGETH----------------LYGWGQPKSYIFSGAKTL 177

  Fly   181 RNVTVTIISIKECRQKF-KSPKIASTSICARQPKNPKQ-CLYDGGSPLIY-----GRELCGVVSF 238
            :.||..|::.:||:::. :|..||.::||:...:..|. |..|.|.||:.     ..||.|:||:
  Fly   178 QTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSW 242

  Fly   239 G-SHCIDTSRPGMYTNIRRVKRFITETEES 267
            | ..|...:.|.:||.:.....:||..:.:
  Fly   243 GYIPCGLANMPSIYTKVSAYIDWITNIQSA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 51/217 (24%)
Tryp_SPc 55..261 CDD:304450 51/217 (24%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 53/220 (24%)
Tryp_SPc 37..266 CDD:214473 51/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.