DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG33160

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:270 Identity:74/270 - (27%)
Similarity:124/270 - (45%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLVSCLLWTCLPQSQG---TVY--PRDILLKTPKFRRVWGGVQSNTGPNFGGWLLRILNGDGNFA 67
            ::..||....|.|..|   .||  |..:.::.    |:.||..|:....  .:|:::...:.  .
  Fly     1 MIARCLTSLFLVQILGFHSAVYAHPDSVQIQP----RIIGGHVSSIKEE--KYLVQVTTSEE--L 57

  Fly    68 CGAAYYAPLLVITSANCIY-PYRNSLEGATVEGTAFSECDRENYADIDTIQF----PEKFIYQKL 127
            ||.:...|..|||:|:|:| ..:|..:   :.|.|.::..  .||.|.|:.:    |: |..:.|
  Fly    58 CGGSLVKPRWVITAAHCVYNKNKNDFK---IYGGASNQAG--PYAVIRTVDYIAIRPD-FNRKTL 116

  Fly   128 YMDVAVVRLRDPVRGRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKE 192
            .||||.:||...:.|...|.|.|.:..|..:..:.|.||||...:....:....:|.|.:.|...
  Fly   117 NMDVAALRLNSDMIGANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRAS 181

  Fly   193 CRQKFKS-PKIASTSICARQPKNPKQCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRR 256
            |...|:. .:|..:.:||.:......|..|.|.||:|..:|.|:||||..|. ::.||:||::..
  Fly   182 CVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGCA-SALPGIYTSVPE 245

  Fly   257 VKRFITETEE 266
            ::.:.....|
  Fly   246 IRDWFQRVVE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 65/227 (29%)
Tryp_SPc 55..261 CDD:304450 61/211 (29%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 65/226 (29%)
Tryp_SPc 34..253 CDD:238113 64/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.