DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and prss59.1

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:241 Identity:54/241 - (22%)
Similarity:100/241 - (41%) Gaps:37/241 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFS 103
            ::.||.:..  ||...|... ||...:| ||.:..:...|:::|:|   |::.:|....|.....
Zfish    20 KIVGGYECQ--PNSQPWQAS-LNSGYHF-CGGSLVSEYWVVSAAHC---YKSRVEVRLGEHNIVI 77

  Fly   104 ECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIR-------------LCSVKV 155
            ....|.:...:.:.....:....|..|:.:::|..|  ..|.::::             :|.|. 
Zfish    78 NEGTEQFITSEKVIRNPNYDSWDLDSDIMLIKLSKP--ATLNKYVQPVALPNGCAADGTMCRVS- 139

  Fly   156 QPKMQMVVFGWGFDNTEVEIPSSDP-RNVTVTIISIKECRQKFKSPKIASTSICARQPKNPK-QC 218
                     |||  ||......|:. :.:.:.|:|.::|...:.. .|..|..||...:..| .|
Zfish   140 ---------GWG--NTMSSTADSNKLQCLEIPILSDRDCNNSYPG-MITDTMFCAGYLEGGKDSC 192

  Fly   219 LYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITET 264
            ..|.|.|::...||.|:||:|..|.:.:.||:|..:....::|.:|
Zfish   193 QGDSGGPVVCNGELHGIVSWGYGCAEKNHPGVYGKVCMFSQWIADT 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 52/236 (22%)
Tryp_SPc 55..261 CDD:304450 48/220 (22%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 52/236 (22%)
Tryp_SPc 21..238 CDD:238113 53/238 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.