DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG31827

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:244 Identity:49/244 - (20%)
Similarity:100/244 - (40%) Gaps:53/244 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYADIDTIQFP 119
            |.:.::: :.:...|.:...|.:|:|:|:.|:       ...||....|..:.|..:.::...|.
  Fly    57 WTIAVIH-NRSLVGGGSLITPDIVLTAAHRIF-------NKDVEDIVVSAGEWEYGSALEKYPFE 113

  Fly   120 EKFI----------YQKLYMDVAVVRL-RD-PVRGRLTEFIRLCSVKVQPKMQMVVFGWG---FD 169
            |.|:          ||:...::|::.| |: |:..::.........:.....:.:|.|||   |.
  Fly   114 EAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSSTRCIVAGWGKYQFS 178

  Fly   170 NT-------EVEIPSSDPRNVTVTIISIKECRQKFKSPKIAST------SICARQPKNPKQCLYD 221
            :|       ::::|.. ||::         |:.:.:..::...      .|||...|:...|..|
  Fly   179 DTHYGGVLKKIDLPIV-PRHI---------CQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGD 233

  Fly   222 GGSPLIYGR-------ELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITE 263
            ||..|....       |..|:|::|..|.:.:.|..||::...|.:|.:
  Fly   234 GGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 48/240 (20%)
Tryp_SPc 55..261 CDD:304450 48/240 (20%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 49/244 (20%)
Tryp_SPc 50..280 CDD:214473 48/240 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.