DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG33159

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:280 Identity:78/280 - (27%)
Similarity:123/280 - (43%) Gaps:34/280 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLSKIWLLVSCLLWTCLPQSQGTVYPRDILLKTPKFRRVWGGVQSNTG--PNFGGWLLRILNGD 63
            :||..:|.|  |.|...||.|..         ||    |:.||.::...  |     .|..|..:
  Fly     2 VGLRLLWWL--CHLALVLPSSSS---------KT----RIVGGKETTISEVP-----YLVYLRQN 46

  Fly    64 GNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYADIDTIQFPEKFIYQ--K 126
            |.|.||.:..:...|:::|:|:  |.:..||.||...| |..|:|.....:.:.|.....|.  .
  Fly    47 GYFICGGSLISSRAVLSAAHCV--YGSQPEGFTVHAGA-SRLDQEAPVVRNVVMFHTSPSYSATN 108

  Fly   127 LYMDVAVVRLRDPV---RGRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTII 188
            ..||||:::|::.|   .|::.. |..|....:......:.|||........|:...|...|.::
  Fly   109 FDMDVALLQLQEVVVLTPGKVAT-ISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVL 172

  Fly   189 SIKECRQKFKS-PKIASTSICARQPKNPKQCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYT 252
            ...||:..:.. .:::.:.:||........|..|.|.||:|..::||:||:|..|...|.||:||
  Fly   173 PGAECKISYSGYGQLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYT 237

  Fly   253 NI--RRVKRFITETEESINA 270
            |:  .||..||.:|...|.:
  Fly   238 NVASERVHEFIEQTLRRIGS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 63/231 (27%)
Tryp_SPc 55..261 CDD:304450 59/213 (28%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 61/224 (27%)
Tryp_SPc 26..251 CDD:238113 64/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.