DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG32808

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:251 Identity:59/251 - (23%)
Similarity:104/251 - (41%) Gaps:59/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RILNG------------------DGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVE------ 98
            :|:||                  .|..:|||....|..|:|:|:|:       .|::.|      
  Fly    29 KIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCV-------RGSSPEQLDLQY 86

  Fly    99 GTAFSECDRENYADIDTIQFPEKFIY------QKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQP 157
            |:.....:....|.:..|     |::      .|...|:|:::|...|  .|::|::  .|::..
  Fly    87 GSQMLARNSSQVARVAAI-----FVHPGYEPEDKYVNDIALLQLAQSV--ALSKFVQ--PVRLPE 142

  Fly   158 KMQM-------VVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNP 215
            ..|:       |:.|||. |....:.....:.|.:.:.|..||.::.:: .:..:.|||..|:..
  Fly   143 PRQVTPGNASAVLAGWGL-NATGGVVQQHLQKVKLQVFSDTECSERHQT-YLHDSQICAGLPEGG 205

  Fly   216 K-QCLYDGGSP-LIYGREL-CGVVSFG-SHCIDTSRPGMYTNIRRVKRFITETEES 267
            | ||..|.|.| |:.|.:. .|:||:. ..|.....||::|.:.....:|.||..|
  Fly   206 KGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWIVETVNS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 55/243 (23%)
Tryp_SPc 55..261 CDD:304450 55/243 (23%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 55/243 (23%)
Tryp_SPc 30..258 CDD:238113 56/245 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.