DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CG6041

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:290 Identity:66/290 - (22%)
Similarity:117/290 - (40%) Gaps:36/290 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSKIWLLVSCLLW--------TCLPQSQGTVYPR-----DILLKTPKFRRVWGGVQSNTGPNFGG 54
            ::|:|.:::..|:        :...::.|.:.|:     |..::...: :|...:.:|...::|.
  Fly     1 MAKVWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSY-QVSIRLTANDKKSYGS 64

  Fly    55 WLLRILNGDGNFACGAAYYAPLLVITSANCIY-----PYRNSLEGATVEGTAF--SECDRENYAD 112
            ..|          ||....:..||.|:|:|.|     .||.:.|...|.|:.:  |..||.....
  Fly    65 GHL----------CGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYY 119

  Fly   113 IDTIQFPEKFIYQKLYMDVAVVRLRD--PVRGRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEI 175
            :..:...|.:....|..|:|::.:..  |........:.|.|..|......::.|||........
  Fly   120 LQQLITHENYNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTF 184

  Fly   176 PSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQ-PKNPKQCLYDGGSPLIYGRELCGVVSFG 239
            .|:..:..||.|:|...||..:.|  |..:.:||.. ......|..|.|.|:.....|.|:||:|
  Fly   185 SSNTLQAATVPIVSYTTCRISYNS--IPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYG 247

  Fly   240 SHCIDTSRPGMYTNIRRVKRFITETEESIN 269
            :.|.....||:|||:.....:|.:...|:|
  Fly   248 AGCAAPGYPGVYTNVSYYYDWIVQKNSSLN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 57/231 (25%)
Tryp_SPc 55..261 CDD:304450 54/215 (25%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 58/247 (23%)
Tryp_SPc 35..272 CDD:238113 59/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.