DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and LOC312273

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:285 Identity:66/285 - (23%)
Similarity:108/285 - (37%) Gaps:78/285 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CLLWTCLPQSQGTV--YPRDILLKTPKFRRVWGG--VQSNTGPNFGGWLLRILNGDGNFACGAAY 72
            |:.:|.|    |||  :|.:     ....|:.||  .|.::.|      .::....|:..||.:.
  Rat     4 CIFFTLL----GTVAAFPTE-----DNDDRIVGGYTCQEHSVP------YQVSLNAGSHICGGSL 53

  Fly    73 YAPLLVITSANCIYPYRN---------SLEGATVEGTAFSECDRENYAD-IDTIQFPEKFIYQKL 127
            .....|:::|:|.:|...         .:|||            |.:.| ...|..|:   |.|.
  Rat    54 ITDQWVLSAAHCYHPQLQVRLGEHNIYEIEGA------------EQFIDAAKMILHPD---YDKW 103

  Fly   128 YM--DVAVVRLRDPVR-GRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIIS 189
            .:  |:.:::|:.|.. ......|.|.........:.:|.|||......|.|            |
  Rat   104 TVDNDIMLIKLKSPATLNSKVSTIPLPQYCPTAGTECLVSGWGVLKFGFESP------------S 156

  Fly   190 IKECRQKFKSPKIASTSIC----ARQPKNPKQCL-----------YDGGSPLIYGRELCGVVSFG 239
            :.:|   ..:| :.|.|:|    .||..|...||           ||.|.|::...|:.|:||:|
  Rat   157 VLQC---LDAP-VLSDSVCHKAYPRQITNNMFCLGFLEGGKDSCQYDSGGPVVCNGEVQGIVSWG 217

  Fly   240 SHCIDTSRPGMYTNIRRVKRFITET 264
            ..|....:||:||.:.....:|.:|
  Rat   218 DGCALEGKPGVYTKVCNYLNWIHQT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 57/251 (23%)
Tryp_SPc 55..261 CDD:304450 52/233 (22%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 57/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.