DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Klk8

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:296 Identity:65/296 - (21%)
Similarity:114/296 - (38%) Gaps:90/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WLLVSCLL--WTCLPQSQGTVYPRDILLKTPKFRRVWGGVQSNTGPNFGGWLLRILNGDGNFACG 69
            |:|:..|:  |..|.::||:              ::..|.:..  |:...|...:..|: ...||
  Rat    12 WILLFLLMGAWAGLTRAQGS--------------KILEGQECK--PHSQPWQTALFQGE-RLVCG 59

  Fly    70 AAYYAPLLVITSANC---IYPYR---NSLE-----------GATVEGTAFSECDRENYADIDTIQ 117
            ........|:|:|:|   .|..|   :||:           ..:::...|:..:.|:::.     
  Rat    60 GVLVGDRWVLTAAHCKKDKYSVRLGDHSLQKRDEPEQEIQVARSIQHPCFNSSNPEDHSH----- 119

  Fly   118 FPEKFIYQKLYMDVAVVRLRDPV----RGRLTEFIRLCSVKVQPKM--QMVVFGWG--------F 168
                        |:.::||::..    :.:..|...||     ||:  :.::.|||        |
  Rat   120 ------------DIMLIRLQNSANLGDKVKPIELANLC-----PKVGQKCIISGWGTVTSPQENF 167

  Fly   169 DNT----EVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPKQCLYDGGSPLIYG 229
            .||    ||:|.|.:            :|.:.:.. ||....:||........|..|.|.||:..
  Rat   168 PNTLNCAEVKIYSQN------------KCERAYPG-KITEGMVCAGSSNGADTCQGDSGGPLVCN 219

  Fly   230 RELCGVVSFGSH-CIDTSRPGMYTNIRRVKRFITET 264
            ..|.|:.|:||. |....:||:||.|.|...:|.:|
  Rat   220 GVLQGITSWGSDPCGKPEKPGVYTKICRYTNWIKKT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 56/257 (22%)
Tryp_SPc 55..261 CDD:304450 54/241 (22%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 56/257 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.