DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Tmprss13

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001121000.1 Gene:Tmprss13 / 300682 RGDID:1310872 Length:539 Species:Rattus norvegicus


Alignment Length:269 Identity:66/269 - (24%)
Similarity:105/269 - (39%) Gaps:70/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GVQSNTGPNFGG---------WLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNS-LEGATV 97
            |:::.||...||         |.:.:..|..:. ||........|:|:|:|.:..|.. |||..|
  Rat   290 GLRAMTGRIVGGALTSESKWPWQVSLHFGTTHI-CGGTLIDAQWVLTAAHCFFVTREKILEGWKV 353

  Fly    98 EGTAFSECDRENYADIDTI-QFPEKFIYQKLYM-----------DVAVVRLRDPVRGRLTEFIRL 150
                        ||....: |.||.....::.:           |:|:|||..|:         .
  Rat   354 ------------YAGTSNLHQLPEAASISQIIINGNYTDEQDDYDIALVRLSKPL---------T 397

  Fly   151 CSVKVQP---KMQMVVFG-----W--GFDNTEVEIPSSDP--RNVTVTIISIKECR-----QKFK 198
            .|..:.|   .:....||     |  ||..|:.....:.|  |.|.|.:|..|:|.     ..:.
  Rat   398 LSAHIHPACLPLHGQTFGLNETCWITGFGKTKETDEKTSPFLREVQVNLIDFKKCNDYLVYDSYL 462

  Fly   199 SPKIASTSICARQPKNPK-QCLYDGGSPLIYGRE----LCGVVSFGSHCIDTSRPGMYTNIRRVK 258
            :|::    :||...:..: .|..|.|.||:..:.    |.||.|:|:.|...::||:||.:..|.
  Rat   463 TPRM----MCAGDLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQKNKPGVYTKVTEVL 523

  Fly   259 RFITETEES 267
            .:|....||
  Rat   524 PWIYRKMES 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 63/261 (24%)
Tryp_SPc 55..261 CDD:304450 58/240 (24%)
Tmprss13NP_001121000.1 WWbp <1..69 CDD:304964
SRCR_2 203..292 CDD:292133 1/1 (100%)
SRCR 216..288 CDD:278931
Tryp_SPc 297..526 CDD:214473 60/254 (24%)
Tryp_SPc 298..526 CDD:238113 60/253 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.