DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and GZMK

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_002095.1 Gene:GZMK / 3003 HGNCID:4711 Length:264 Species:Homo sapiens


Alignment Length:235 Identity:63/235 - (26%)
Similarity:107/235 - (45%) Gaps:25/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECD 106
            ||  ....|:...::..|..| |:..||.....|..|:|:|:|.|.:........|.|   :...
Human    29 GG--KEVSPHSRPFMASIQYG-GHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLG---AHSL 87

  Fly   107 RENYADIDTIQFPEKFI-YQKLYM-----DVAVVRLRDPVRGRLTEFIRLCSVKVQPKM----QM 161
            .:|.|...|::. :||| :.::..     |:.:|:|:  ...:|.:.:::..::.:..:    :.
Human    88 SKNEASKQTLEI-KKFIPFSRVTSDPQSNDIMLVKLQ--TAAKLNKHVKMLHIRSKTSLRSGTKC 149

  Fly   162 VVFGWGFDNTEVEIPSSDPRNVTVTIISIKECR-QKFKS--PKIASTSICARQPKNPK-QCLYDG 222
            .|.|||..:.:...||...|.||||::|.|.|. |.:.:  |.|....:||...|..| .|..|.
Human   150 KVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDS 214

  Fly   223 GSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFIT 262
            |.|||.......:||.|..|...::||:||.:  .|::.|
Human   215 GGPLICKGVFHAIVSGGHECGVATKPGIYTLL--TKKYQT 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 62/232 (27%)
Tryp_SPc 55..261 CDD:304450 59/219 (27%)
GZMKNP_002095.1 Tryp_SPc 26..254 CDD:214473 63/235 (27%)
Tryp_SPc 27..257 CDD:238113 63/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.