DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Gzmk

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:247 Identity:63/247 - (25%)
Similarity:105/247 - (42%) Gaps:29/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ILLKTPKFR-RVWGG--VQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNS 91
            |.:.:..|. .:.||  ||.::.|     .:..:...|...||.....|..|:|:|:|   |...
  Rat    15 IYMSSESFHTEIIGGREVQPHSRP-----FMASIQYRGKHICGGVLIHPQWVLTAAHC---YSRG 71

  Fly    92 LEGATVEGT---AFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCSV 153
            .....|.|.   :.:|..::.:...:.|.|..   ::....|:.:::||  ....|.:.::|..:
  Rat    72 HSPTVVLGAHSLSKNEPMKQTFEIKEFIPFSG---FKSGTNDIMLIKLR--TAAELNKHVQLLHL 131

  Fly   154 K----VQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKF---KSPKIASTSICARQ 211
            :    ::...:..|.|||....:|...|...:.|||||||.|.|..:.   ..|.|....|||..
  Rat   132 RSKNYIRDGTKCQVTGWGSTKPDVLTTSDTLQEVTVTIISRKRCNSQSYYNHKPVITKDMICAGD 196

  Fly   212 PKNPK-QCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFIT 262
            .:..| .|..|.|.|||.......:||.|..|..:::||:||.:  .|::.|
  Rat   197 RRGEKDSCKGDSGGPLICKGVFHALVSGGYKCGISNKPGVYTLL--TKKYQT 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 60/234 (26%)
Tryp_SPc 55..261 CDD:304450 55/216 (25%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 61/237 (26%)
Tryp_SPc 26..251 CDD:238113 61/236 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.