DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Tmprss11g

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001008554.1 Gene:Tmprss11g / 289546 RGDID:1306446 Length:417 Species:Rattus norvegicus


Alignment Length:246 Identity:67/246 - (27%)
Similarity:106/246 - (43%) Gaps:28/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LKTPKFRRVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRN----SL 92
            ::.|:..|:..|  ...|.|...| ...|..:|...|||:......::|||:|...|:|    ::
  Rat   178 MEYPRIARIADG--KPAGSNSWPW-QSSLQVEGIHLCGASLIGSQWLVTSAHCFDNYKNPKLWTV 239

  Fly    93 EGATVEGTAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIR-LC----S 152
            ......|...:.      ..:::|...|.:...|...|:|||:|..||  ..:|.:| :|    :
  Rat   240 SFGRTLGNPLTT------RKVESIIIHENYAAHKHDDDIAVVKLSSPV--LFSENLRTVCLPEAT 296

  Fly   153 VKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQ-KFKSPKIASTSICAR-QPKNP 215
            .:|.||.::.|.|||........|:| .:.|.:.|||...|.| ......|:|..|||. .....
  Rat   297 FQVLPKSKVFVTGWGALKANGPFPNS-LQEVEIEIISNDVCNQVNVYGGAISSGMICAGFLTGKL 360

  Fly   216 KQCLYDGGSPLIYGRE-----LCGVVSFGSHCIDTSRPGMYTNIRRVKRFI 261
            ..|..|.|.||:....     |.|:||:|..|...::||:||.:...:.:|
  Rat   361 DACEGDSGGPLVISDNRNKWYLLGIVSWGIDCGKENKPGIYTRVTHYRNWI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 65/237 (27%)
Tryp_SPc 55..261 CDD:304450 61/221 (28%)
Tmprss11gNP_001008554.1 SEA 48..142 CDD:279699
Tryp_SPc 185..411 CDD:214473 65/237 (27%)
Tryp_SPc 186..414 CDD:238113 65/238 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.