DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and F11

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_005262878.1 Gene:F11 / 2160 HGNCID:3529 Length:626 Species:Homo sapiens


Alignment Length:260 Identity:58/260 - (22%)
Similarity:107/260 - (41%) Gaps:40/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TPKFR-RVWGGVQSNTGPNFGGW----LLRILNGDGNFACGAAYYAPLLVITSANCIY------- 86
            |.|.: |:.||..|..|.    |    .|...:......||.:......::|:|:|.|       
Human   382 TTKIKPRIVGGTASVRGE----WPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKI 442

  Fly    87 --PYRNSLEGATV-EGTAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFI 148
              .|...|..:.: |.|:|        ..:..|...:::...:...|:|:::|...|  ..|:..
Human   443 LRVYSGILNQSEIKEDTSF--------FGVQEIIIHDQYKMAESGYDIALLKLETTV--NYTDSQ 497

  Fly   149 RLCSVKVQPKMQMV-----VFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSIC 208
            |...:..:....::     |.|||:.....:|.:: .:...:.:::.:||:::::..||....||
Human   498 RPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNT-LQKAKIPLVTNEECQKRYRGHKITHKMIC 561

  Fly   209 ARQPKNPKQ-CLYDGGSPLIYGR----ELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITETEESI 268
            |...:..|. |..|.|.||....    .|.|:.|:|..|....|||:|||:.....:|.|..:::
Human   562 AGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV 626

  Fly   269  268
            Human   627  626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 54/245 (22%)
Tryp_SPc 55..261 CDD:304450 49/229 (21%)
F11XP_005262878.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..375 CDD:128519
Tryp_SPc 388..619 CDD:214473 54/245 (22%)
Tryp_SPc 389..619 CDD:238113 53/244 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.