DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and svh-1

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:251 Identity:57/251 - (22%)
Similarity:94/251 - (37%) Gaps:56/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KFRRVWGGVQSNTGPNFGGWLLRILN-GDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEG 99
            :..||.||.:  |.|....|...:.| ......|||:......:||:|:|               
 Worm   709 RIARVVGGFE--TVPGAFPWTAALRNKATKAHHCGASILDKTHLITAAHC--------------- 756

  Fly   100 TAFSECDRENYADI-------------DTIQFPEKFIYQKLYMDV---AVVRLRDPVRG-RLTEF 147
              |.|.:|.:..::             :.|.:.::..:..||.|:   .:..|..|..| ...|:
 Worm   757 --FEEDERVSSYEVVVGDWDNNQTDGNEQIFYLQRIHFYPLYKDIFSHDIAILEIPYPGIEFNEY 819

  Fly   148 IR-LC----SVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKEC---RQKFKSPKIAS 204
            .: :|    .....|..|.||.|||......   :...:...:.||:..:|   .|.:.|  ::.
 Worm   820 AQPICLPSKDFVYTPGRQCVVSGWGSMGLRY---AERLQAALIPIINRFDCVNSSQIYSS--MSR 879

  Fly   205 TSICARQPKNP-KQCLYDGGSPLIYGRE-----LCGVVSFGSHCIDTSRPGMYTNI 254
            ::.||...:.. ..|..|.|.|....||     |.||:|:|..|....:||:||.:
 Worm   880 SAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYTMV 935

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 57/248 (23%)
Tryp_SPc 55..261 CDD:304450 51/232 (22%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 56/247 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.