DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CFD

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:247 Identity:55/247 - (22%)
Similarity:91/247 - (36%) Gaps:53/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PKFRRVWGG--VQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGAT- 96
            |...|:.||  .:::..|......|     :|...||....|...|:::|:|:   .::.:|.. 
Human    28 PPRGRILGGREAEAHARPYMASVQL-----NGAHLCGGVLVAEQWVLSAAHCL---EDAADGKVQ 84

  Fly    97 ----VEGTAFSECDRENYADIDTIQFPEK------------FIYQKLYMDVAVVRL------RDP 139
                ....:..|..:..|..:..:..|:.            .:.:|..:..||..|      ||.
Human    85 VLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDV 149

  Fly   140 VRGRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKEC-RQKFKSPKIA 203
            ..|.|.:                |.|||..|.....|.| .::|.:.::....| |:......|.
Human   150 APGTLCD----------------VAGWGIVNHAGRRPDS-LQHVLLPVLDRATCNRRTHHDGAIT 197

  Fly   204 STSICARQPKNPKQCLYDGGSPLIYGRELCGVVSFGSH-CIDTSRPGMYTNI 254
            ...:||...:. ..|..|.|.||:.|..|.|||:.||. |.:..:||:||.:
Human   198 ERLMCAESNRR-DSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 54/243 (22%)
Tryp_SPc 55..261 CDD:304450 50/225 (22%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 54/243 (22%)
Tryp_SPc 33..258 CDD:238113 53/242 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.