DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Gzmk

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:274 Identity:75/274 - (27%)
Similarity:108/274 - (39%) Gaps:46/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WLLVSCLLWTCLPQSQGTVYPRDILLKTPKFRRVWGG--VQSNTGPNFGGWLLRILNGDGNFACG 69
            |.|||.:         ..||.......|    .:.||  ||.::.|     .:..:.......||
Mouse     6 WALVSLV---------AGVYMSSECFHT----EIIGGREVQPHSRP-----FMASIQYRSKHICG 52

  Fly    70 AAYYAPLLVITSANCI--YPYRNSLEGATVEGTAFSECDRENYADIDTIQFPEKFI-YQKLYM-- 129
            .....|..|:|:|:|.  :|..:|   .||...|.|....|.......|   :||| :.:|..  
Mouse    53 GVLIHPQWVLTAAHCYSWFPRGHS---PTVVLGAHSLSKNEPMKQTFEI---KKFIPFSRLQSGS 111

  Fly   130 ---DVAVVRLRDPVR-GRLTEFIRLCS---VKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTI 187
               |:.:::||.... .:..:.:.|.|   ::...|.|  |.|||....::...|...|.|||||
Mouse   112 ASHDIMLIKLRTAAELNKNVQLLHLGSKNYLRDGTKCQ--VTGWGTTKPDLLTASDTLREVTVTI 174

  Fly   188 ISIKECRQKF---KSPKIASTSICARQPKNPK-QCLYDGGSPLIYGRELCGVVSFGSHCIDTSRP 248
            ||.|.|..:.   ..|.|....|||...:..| .|..|.|.|||.......:||.|..|....:|
Mouse   175 ISRKRCNSQSYYNHKPVITKDMICAGDARGQKDSCKGDSGGPLICKGIFHALVSQGYKCGIAKKP 239

  Fly   249 GMYTNIRRVKRFIT 262
            |:||.:  .|::.|
Mouse   240 GIYTLL--TKKYQT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 67/239 (28%)
Tryp_SPc 55..261 CDD:304450 62/221 (28%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 68/242 (28%)
Tryp_SPc 26..256 CDD:238113 68/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.