DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and PRSS36

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:313 Identity:69/313 - (22%)
Similarity:117/313 - (37%) Gaps:74/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PRDILLKTPK-FRRVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRN 90
            |.|:....|: ..|:.||  ||..|....|.:.:.:|.|:. ||.:..||..|:::|:| :....
Human    33 PEDLDCGRPEPSARIVGG--SNAQPGTWPWQVSLHHGGGHI-CGGSLIAPSWVLSAAHC-FMTNG 93

  Fly    91 SLEGATVEGTAFSECDRENYAD------IDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIR 149
            :||.|...........::...|      :..|..|..:...:|..|:|::||..|          
Human    94 TLEPAAEWSVLLGVHSQDGPLDGAHTRAVAAIVVPANYSQVELGADLALLRLASP---------- 148

  Fly   150 LCSVKVQPKMQMVVF----------------GWGFDNTEVEIPSSDP-------RNVTVTIISIK 191
               ..:.|.:..|..                |||      ::..:||       :.|.:.::...
Human   149 ---ASLGPAVWPVCLPRASHRFVHGTACWATGWG------DVQEADPLPLPWVLQEVELRLLGEA 204

  Fly   192 ECRQKFKSP-------KIASTSICARQPKNPKQ-CLYDGGSPLIY---GREL-CGVVSFGSHCID 244
            .|:..:..|       :|....:||..|:..:. |..|.|.||:.   ||.. .|:.|||..|..
Human   205 TCQCLYSQPGPFNLTLQILPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGFGCGR 269

  Fly   245 TSRPGMYTNIRRVKRFITETEESINAGDVFRSTKVVKETKKPPKKTIKPKSKP 297
            .:|||::|.:...:.:|.|.......|..|.:         .|:||.....:|
Human   270 RNRPGVFTAVATYEAWIREQVMGSEPGPAFPT---------QPQKTQSDPQEP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 58/262 (22%)
Tryp_SPc 55..261 CDD:304450 52/246 (21%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 58/262 (22%)
Tryp_SPc 47..289 CDD:238113 58/264 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316 6/31 (19%)
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.