DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and AgaP_AGAP001241

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_321913.5 Gene:AgaP_AGAP001241 / 1281929 VectorBaseID:AGAP001241 Length:267 Species:Anopheles gambiae


Alignment Length:243 Identity:62/243 - (25%)
Similarity:107/243 - (44%) Gaps:29/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PKFRRVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCI--YPYRNSLEGATV 97
            |:..|:.||.::..........||..|   |..||.:..:...|:|:|:|:  ||:.:.:   ||
Mosquito    38 PRADRIVGGSKTTIESVPYQVSLRYFN---NHICGGSIISHSWVLTAAHCLDWYPHNDEI---TV 96

  Fly    98 EGTAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPV---RGRLTEFIRLC-SVKVQPK 158
            ...:.|:....:...:......|::...:...|||.||:|.|:   .||..  |.|. |.:....
Mosquito    97 RTGSTSQSAGGSLHAVFYYHLHERYDPNEFQWDVATVRVRTPMGLGAGRAP--IPLATSTEWTVG 159

  Fly   159 MQMVVFGWGFDNTEVEIPSSDPRNVTVTIISI-----KECRQKFKSPKIASTSICARQPKNPKQC 218
            .:::|.|||:      :.::...|.|:.:|.:     :.|.:.: :..|.:..:||..| ....|
Mosquito   160 ERILVTGWGY------LTAAGKVNDTLQMILLDAVPQESCNRTW-TGFITADMLCAGGP-GVDAC 216

  Fly   219 LYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRR--VKRFITET 264
            ..|.|.|.:......|:||:||.......||::|||..  |:.||..|
Mosquito   217 AGDSGGPAVQDGVQYGIVSWGSIDCGNGLPGVFTNIAHPSVRSFIRRT 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 58/234 (25%)
Tryp_SPc 55..261 CDD:304450 55/218 (25%)
AgaP_AGAP001241XP_321913.5 Tryp_SPc 42..261 CDD:214473 58/234 (25%)
Tryp_SPc 43..264 CDD:238113 59/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.