DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and AgaP_AGAP001964

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_321098.5 Gene:AgaP_AGAP001964 / 1281159 VectorBaseID:AGAP001964 Length:363 Species:Anopheles gambiae


Alignment Length:254 Identity:58/254 - (22%)
Similarity:98/254 - (38%) Gaps:49/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WLLRILNGDGN---FACGAAYYAPLLVITSANCIYPYRNSLEGATVE--GTAFSECDRENYAD-- 112
            |:..:.....:   :.||.......:|||.|:||       |..|..  .....|.|.|:..:  
Mosquito   124 WMAFVYTAQADYELYLCGGTLVHSKVVITIAHCI-------ENRTASELRVRLGEWDLEHMVEIY 181

  Fly   113 -------IDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQ----PKMQMVVFGW 166
                   |..:..|: |..:.|..|:|::.|.:.|  ..||.:.:..:..|    ...:.:..||
Mosquito   182 PPQDRAVIAAVTHPQ-FYSELLLNDIAILFLDEHV--DFTEVVGIACLPPQNANFDHKRCLFTGW 243

  Fly   167 GFDNTEVEIPSSDPRNVTVTIISIKECRQKF------KSPKIASTSICARQPKNPKQCLYDGGSP 225
            |.|  |....||..:...:.|:...:|::..      :|.::....:||........|..|||||
Mosquito   244 GED--ERGRNSSVLKRTKLPIVPNGQCQRVLRRHLLNRSFRLHQGFLCAGGESGKDACRGDGGSP 306

  Fly   226 LI----------YGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITETEESINAGDVF 274
            |:          |   :.|:|:||..|.....||:|.|:...:.:|....|.:...|:|
Mosquito   307 LVCPIPQSENQYY---VVGLVAFGYECGTQGVPGVYVNVPHYRDWIDGEIEKMYHVDIF 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 54/239 (23%)
Tryp_SPc 55..261 CDD:304450 54/239 (23%)
AgaP_AGAP001964XP_321098.5 Tryp_SPc 117..350 CDD:238113 54/240 (23%)
Tryp_SPc 117..349 CDD:214473 54/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.