DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and AgaP_AGAP009121

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_319873.4 Gene:AgaP_AGAP009121 / 1280073 VectorBaseID:AGAP009121 Length:269 Species:Anopheles gambiae


Alignment Length:249 Identity:60/249 - (24%)
Similarity:96/249 - (38%) Gaps:55/249 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVWGGVQSNTG--PNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIY---PYRNSLEGATVE 98
            ||.||:.:..|  |:... :.|::.......||.:..:...|:|:|:||.   ...|....|...
Mosquito    31 RVVGGIDALPGEFPSIVS-IQRVILVVSTHICGGSILSNFWVLTAAHCITENPATANFAIWAGTH 94

  Fly    99 GTAFSECDRENYADIDTIQFPEKFIYQKLY--MDVAVVRLRDPVRGRLTEFIRLCSVKVQPKMQM 161
            .||.:|..|:..:...:...|:   ||...  .|:||:||..|             :...|::|.
Mosquito    95 NTAITEDTRQVISVASSTVHPD---YQGGVNPTDIAVMRLAAP-------------LTFTPRIQP 143

  Fly   162 VVF--------------GWGFDNTEVEIPSSDPRNVTVTIISIKECRQK--FKSPKIASTSICAR 210
            ||.              |||.....:....:..:.||..||..:|||..  ..:| :..|::|. 
Mosquito   144 VVLPAPGSTPSGPATLAGWGSTGGTLPTLPNILQKVTKPIIPFEECRSAAGVDAP-LGPTNVCT- 206

  Fly   211 QPKNP-----KQCLYDGGSPLI---YGREL-CGVVSFG-SHCIDTSRPGMYTNI 254
               .|     ..|..|.|.||.   .|::: .|:||:| ..|.....|.:|..:
Mosquito   207 ---GPLTGGVSACSGDSGGPLYTVQNGQQVQVGIVSWGWIPCGTIGFPSVYVGV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 60/249 (24%)
Tryp_SPc 55..261 CDD:304450 54/231 (23%)
AgaP_AGAP009121XP_319873.4 Tryp_SPc 31..264 CDD:214473 60/249 (24%)
Tryp_SPc 32..267 CDD:238113 59/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.