DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and AgaP_AGAP008994

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_319744.4 Gene:AgaP_AGAP008994 / 1279956 VectorBaseID:AGAP008994 Length:250 Species:Anopheles gambiae


Alignment Length:247 Identity:63/247 - (25%)
Similarity:97/247 - (39%) Gaps:46/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KFRRVWGGVQSNTGPNFGGWLLRILNGDGNF-------ACGAAYYAPLLVITSANCIYPYRNSLE 93
            |..||.||..|    .||.|..::|..:..:       .||........|||:|:|...:..||.
Mosquito     2 KSGRVVGGKAS----KFGEWPWQVLVRESTWLGLFTKNKCGGVLITNEYVITAAHCQPGFLASLV 62

  Fly    94 GATVEGTAFSECDRENYADIDT----IQFPEKFIYQKLY------MDVAVVRLRDPVRGRLTEFI 148
                  ..|.|.|..  :|::|    .:..::.|..:.|      .|:|::.|.:|:...: ..:
Mosquito    63 ------AVFGEFDIS--SDLETKRSVTKNVKRVIVHRQYDAATFENDLAILELENPIHYDV-HIV 118

  Fly   149 RLC----SVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKF----KSPKIAST 205
            .:|    ......:|..|. |||.......:||. .:.|.|.:|....|::.|    .:.||..:
Mosquito   119 PICMPGDEADFTGRMATVT-GWGRLTYGGGVPSV-LQEVQVPVIENSVCQEMFHMAGHNKKILPS 181

  Fly   206 SICARQPKNPK-QCLYDGGSPLIYGR-----ELCGVVSFGSHCIDTSRPGMY 251
            .:||......: .|..|.|.||:..|     ||.|.||.|..|.....||:|
Mosquito   182 FVCAGYANGKRDSCEGDSGGPLVLQRPDGRYELVGTVSHGIRCAAPYLPGVY 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 62/244 (25%)
Tryp_SPc 55..261 CDD:304450 55/228 (24%)
AgaP_AGAP008994XP_319744.4 Tryp_SPc 5..242 CDD:214473 62/244 (25%)
Tryp_SPc 6..246 CDD:238113 61/243 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.