DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and AgaP_AGAP008861

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_319603.2 Gene:AgaP_AGAP008861 / 1279828 VectorBaseID:AGAP008861 Length:259 Species:Anopheles gambiae


Alignment Length:258 Identity:55/258 - (21%)
Similarity:89/258 - (34%) Gaps:82/258 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GGWLLRI--------LNGDGNFACGAAYYAPLLVITSANCI---------------YPYRNSL-- 92
            ||:.:.|        |...|:.:||.:..:|..::|:|:|:               |.....:  
Mosquito    33 GGFPIDISEAPYQISLREGGHPSCGGSIISPDWILTAAHCLEGVSADQVSIRAGSTYKMHGGVLR 97

  Fly    93 -----------EGATVEG-TAFSECDRENYADIDT---IQFPEKFIYQKLYMDVAVVRLRDPVRG 142
                       :..|.|| .|..|.:.....|.||   |:.||:             ...|||.|
Mosquito    98 NVARVVLHPAWDPVTNEGDIALMELESPLPLDGDTMASIEMPEQ-------------DEEDPVEG 149

  Fly   143 RLTEFIRLCSVKVQPKMQMVVFGWG-----FDNTEVEIPSSDPRNVTVTIISIKECRQKF-KSPK 201
                            .:.:|.|||     |.:..:      .|...:.|:....|::.: ::..
Mosquito   150 ----------------SKALVSGWGKTLNRFHSALI------LRATFLPIVHRDNCQKAYRRTHT 192

  Fly   202 IASTSICAR-QPKNPKQCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITE 263
            |:...:||. .......|..|.|.||:....|.|||||...|.....||:...:..|:.:|.|
Mosquito   193 ISEMMLCAGFFEGGHDSCQGDSGGPLVVDDVLVGVVSFAIGCARPGLPGVNARVSAVRDWIRE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 53/254 (21%)
Tryp_SPc 55..261 CDD:304450 51/252 (20%)
AgaP_AGAP008861XP_319603.2 Tryp_SPc 31..256 CDD:238113 55/258 (21%)
Tryp_SPc 31..253 CDD:214473 53/254 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.