DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and AgaP_AGAP011477

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_317829.4 Gene:AgaP_AGAP011477 / 1278364 VectorBaseID:AGAP011477 Length:276 Species:Anopheles gambiae


Alignment Length:216 Identity:54/216 - (25%)
Similarity:89/216 - (41%) Gaps:40/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ACGAAYYAPLLVITSANCI-YPYRNSLEGATVEGTAFSECDRENYADIDTIQFPEKFIYQ--KLY 128
            :||.|......::|:|:|: ||   .|..:..|..|.|....|....|...|......|.  .|.
Mosquito    76 SCGGAILNTNTILTAAHCVDYP---ELVPSDFEVRAGSTFRNEGGQLITVAQIHTHPSYNDWTLE 137

  Fly   129 MDVAVVRLRDPVRGRLTEFIRLCSVKVQPKMQMV----------------VFGWGFDNTEVEIPS 177
            .|::|::|             :.|:::.|.:|.:                :.|||  :...:.||
Mosquito   138 WDISVLKL-------------VSSLQLSPTVQPISLPDRGLTIPDGTSVSLAGWG--SLYYQGPS 187

  Fly   178 SDP-RNVTVTIISIKECRQKFKS-PKIASTSICARQPKNPKQCLYDGGSPLIYGRELCGVVSFGS 240
            ::. ::|.:.|:|...|...:|: ..|....|||.. |....|..|.|.||:|...:.|:||:|.
Mosquito   188 TNHLQHVMLPIVSNSRCGMAYKNFAPILPFHICAGH-KGKDACQGDSGGPLVYQSRVVGIVSWGY 251

  Fly   241 HCIDTSRPGMYTNIRRVKRFI 261
            .|...:.|.:||.:.....||
Mosquito   252 GCAFENYPSVYTRVSEFLDFI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 52/214 (24%)
Tryp_SPc 55..261 CDD:304450 52/214 (24%)
AgaP_AGAP011477XP_317829.4 Tryp_SPc 51..272 CDD:214473 52/214 (24%)
Tryp_SPc 52..272 CDD:238113 52/214 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.