DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and AgaP_AGAP006486

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_316523.4 Gene:AgaP_AGAP006486 / 1277090 VectorBaseID:AGAP006486 Length:287 Species:Anopheles gambiae


Alignment Length:227 Identity:49/227 - (21%)
Similarity:77/227 - (33%) Gaps:51/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYA----DIDTIQFPEKFIYQ 125
            |..||........|:|:|.|:...:|:|..|. :....|...:.|:.    .|..:....::...
Mosquito    66 NAFCGGVILNENHVLTAARCVLTPQNTLLFAN-QLNILSGMLQLNFGAPRIGITAVYVHPQYNPF 129

  Fly   126 KLYMDVAVVRLRD-------PVRG-RLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDPRN 182
            ....::||:|...       ||.. ...:|....:...||   ..|.||              .|
Mosquito   130 TFEHNIAVLRTSSNFFFPVVPVPNVDFAQFYEEIAFDGQP---CQVVGW--------------NN 177

  Fly   183 VTVTIISIKECRQKFKSP---------------KIASTSICARQPK-NPKQCLYDGGSPLIYGRE 231
            .|.|.:     :|...:|               .|..:.:||.... .|..|..:.|:.|.....
Mosquito   178 GTATPV-----QQFINAPILNRDTCNGLAVHLGNIRESMVCAGVTNAGPGVCASNLGTGLFCEGR 237

  Fly   232 LCGVVSFGSHCIDTSRPGMYTNIRRVKRFITE 263
            |.|::|.|..|...:.||:||.||....:|.|
Mosquito   238 LAGILSTGLGCGQANNPGVYTQIRYYLPWIRE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 47/223 (21%)
Tryp_SPc 55..261 CDD:304450 47/223 (21%)
AgaP_AGAP006486XP_316523.4 Tryp_SPc 41..270 CDD:238113 49/227 (22%)
Tryp_SPc 41..267 CDD:214473 47/223 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.