DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and AgaP_AGAP004552

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_313850.5 Gene:AgaP_AGAP004552 / 1274693 VectorBaseID:AGAP004552 Length:349 Species:Anopheles gambiae


Alignment Length:274 Identity:70/274 - (25%)
Similarity:107/274 - (39%) Gaps:63/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CLPQSQGTVYPRDILLKTPKFRRVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITS 81
            |.|...|:|.|.:        .|:.||:.  ...|...| :..|..|..|.||.:..:...|||:
Mosquito    96 CTPCKCGSVEPIN--------ERIVGGIP--VEDNSFSW-MAALYYDNKFCCGGSLLSDRYVITA 149

  Fly    82 ANC-IYPYRNSLEGATVEGTAFSECDRENYADIDT-IQFPEKFIYQKLY------MDVAVVRLRD 138
            |:| ..|.|....      ..|...||..  .|.| |:...|.|....|      .|:|::.|..
Mosquito   150 AHCTTKPDRGLFR------VQFGINDRSK--PIATSIERSVKRILTNWYNAFNNNNDIALLELTY 206

  Fly   139 PV--RGRLTEFIRLCSVKVQPKMQMVVFGWGFDNT---------EVEIPSSDPRNVTVTIISIKE 192
            ||  ..|:.......:.::....:.:|.|||....         :.|:|          |::.:|
Mosquito   207 PVAISDRVMPICLPQATEMYEGSRGIVTGWGRTKAGGGLSGTLMQTEVP----------ILTNRE 261

  Fly   193 CRQK-FKSPKIASTSICARQPKNPK-QCLYDGGSPL--------IYGRELCGVVSFGSHCIDTSR 247
            ||:. :.:.:|.:..:||...:..| .|..|.|.||        .|  ||.||||:|..|...:.
Mosquito   262 CRRAGYWAFQITNKMLCAGYLEGGKDSCQGDSGGPLQVLNTKSNHY--ELVGVVSWGRACAQKNF 324

  Fly   248 PGMYTNIRRVKRFI 261
            ||:|.   ||.:::
Mosquito   325 PGVYA---RVSQYL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 65/250 (26%)
Tryp_SPc 55..261 CDD:304450 61/234 (26%)
AgaP_AGAP004552XP_313850.5 Tryp_SPc 110..338 CDD:214473 65/252 (26%)
Tryp_SPc 111..341 CDD:238113 64/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.