DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and AgaP_AGAP010659

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_311380.4 Gene:AgaP_AGAP010659 / 1272466 VectorBaseID:AGAP010659 Length:393 Species:Anopheles gambiae


Alignment Length:274 Identity:65/274 - (23%)
Similarity:109/274 - (39%) Gaps:55/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QSNTGPNFGGWLLRILNG-DGNFA---------------CGAAYYAPLLVITSANCIYPYRN--- 90
            ||..|      .|||:|| :.|.|               |||:......|.|:|:|:|..:|   
Mosquito     1 QSKAG------FLRIVNGKNANIASYPYIVRLRVNSAGVCGASIITYTHVFTAAHCLYKNQNPAS 59

  Fly    91 -SLEGATVEGTAFSECDRENYADIDTIQFPEKFIYQKLY------MDVAVVRLRDPVRG-RLTEF 147
             :|.|.:...|:..           .:.|..|.|....|      .|..:|::::..:| :....
Mosquito    60 ITLYGGSTSQTSGG-----------VVFFASKVIIHPYYNPETHNYDAGIVQIKNSFQGYKNIAP 113

  Fly   148 IRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECR---QKFKSPKIASTSICA 209
            |.|..|:|.........|||::|.:.:....:.:..|:.:||.::|.   ..:.:|:.    |||
Mosquito   114 IALQDVEVPSDTTCYAAGWGYNNYDRKTSPDNLQYATLQVISPQQCSAGWSSYATPQF----ICA 174

  Fly   210 RQPKNPKQCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITETEESINAGDVF 274
            :|..|...|..|.|.|.:...:|.|..|:|........|..:|.|.......::|    :.|.||
Mosquito   175 QQNNNGDVCNGDSGGPFVCNDKLTGATSYGGVACRGKLPSAFTKITLYGGSASQT----SGGIVF 235

  Fly   275 RSTKVVKETKKPPK 288
            .:.||:...:..|:
Mosquito   236 FACKVIIHPQYDPE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 58/245 (24%)
Tryp_SPc 55..261 CDD:304450 55/235 (23%)
AgaP_AGAP010659XP_311380.4 Tryp_SPc 8..222 CDD:214473 54/228 (24%)
Tryp_SPc 9..222 CDD:238113 53/227 (23%)
Trypsin <239..379 CDD:278516 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.