DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and AgaP_AGAP011325

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_309327.4 Gene:AgaP_AGAP011325 / 1270612 VectorBaseID:AGAP011325 Length:631 Species:Anopheles gambiae


Alignment Length:245 Identity:61/245 - (24%)
Similarity:96/245 - (39%) Gaps:58/245 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFS-----ECDRENYADID 114
            |:..:.:.:..|.||........|:|:|:|   :|..|...:|....|.     :||:..    :
Mosquito   398 WMALLQDTELAFVCGGTLINKRYVLTAAHC---FREKLSKISVRLGEFDLKSDIDCDKRG----E 455

  Fly   115 TIQFP------EKFIYQKLYM------DVAVVRLRDPVRGRLTEFIRLCSVKVQPKMQMV----- 162
            ....|      |:.|..|.|.      |:|::||..  .....|.:....:.|.|:|:.|     
Mosquito   456 RCALPPQDIAVERTIKHKDYSARHKVNDIALIRLAS--EASYNENVMPICLPVSPEMRTVKEIYY 518

  Fly   163 VFGWGFDNTEVEIPSSD----------PRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPKQ 217
            |.|||....:.   |||          |.:|...::     ::|.|...:.|..:||........
Mosquito   519 VSGWGLTENDT---SSDVLQVGLLRQLPNDVCQQLL-----QRKDKYVTVNSDQMCAIGANRTDN 575

  Fly   218 CLYDGGSPL----IYGREL-CGVVSFGSH-CIDTSRPGMYTNIRRVKRFI 261
            |..|.|.||    :..|.: .||||:|.. |...:.||:||   ||:.:|
Mosquito   576 CSGDSGGPLKTVAVNARFVQYGVVSYGLRTCGKETAPGVYT---RVENYI 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 60/243 (25%)
Tryp_SPc 55..261 CDD:304450 60/243 (25%)
AgaP_AGAP011325XP_309327.4 Tryp_SPc 44..287 CDD:238113
Tryp_SPc 46..286 CDD:214473
Tryp_SPc 384..625 CDD:214473 61/245 (25%)
Tryp_SPc 385..625 CDD:238113 61/245 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.