DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and CTR2_ANOGA

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_309032.2 Gene:CTR2_ANOGA / 1270347 VectorBaseID:AGAP006711 Length:258 Species:Anopheles gambiae


Alignment Length:260 Identity:61/260 - (23%)
Similarity:104/260 - (40%) Gaps:49/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSKIWLLVSCLLWTCLPQSQGTVYPRDILLKTPKFRRVWGGVQSNTGP-------NFGGWLLRIL 60
            |.|::.:||.||..    |...|  ..::|......||.||..:..|.       ...||     
Mosquito     2 LRKVFAVVSVLLVV----SAAKV--TKLVLDDHYVNRVVGGEVAKNGSAPYQVSLQVPGW----- 55

  Fly    61 NGDGNFACGAAYYAPLLVITSANCIYPYR----------NSL-EGATVEGTAFSECDRENYADID 114
                ...||.:......|:|:|:|:..|.          ||| ||..:             ..:|
Mosquito    56 ----GHNCGGSLLNNRWVLTAAHCLVGYEPSDLMVLVGTNSLKEGGEL-------------LKVD 103

  Fly   115 TIQFPEKFIYQKLYMDVAVVRLRDPVR-GRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSS 178
            .:.:..::...:.:.|:.::||..||: ..|.:.:......|.....:.:.|||..:|...:|:.
Mosquito   104 KLLYHSRYNRPQFHNDIGLMRLEQPVQFSELVQSVEYLEKAVPVNATVRLTGWGRTSTNGNVPTL 168

  Fly   179 DPRNVTVTIISIKECRQKFKSPK-IASTSICARQPKNPKQCLYDGGSPLIYGRELCGVVSFGSHC 242
             .:::.|..:|.::|:.|..:|| :....:|.........|..|.|.||:|..:|.|||:||..|
Mosquito   169 -LQSLNVVTLSNEDCKAKMGNPKNVDLGHVCTLTKAGEGACNGDSGGPLVYEGKLVGVVNFGVPC 232

  Fly   243  242
            Mosquito   233  232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 52/224 (23%)
Tryp_SPc 55..261 CDD:304450 46/201 (23%)
CTR2_ANOGAXP_309032.2 Tryp_SPc 32..250 CDD:214473 52/224 (23%)
Tryp_SPc 33..253 CDD:238113 51/223 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.