DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Cfi

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_031712.2 Gene:Cfi / 12630 MGIID:105937 Length:603 Species:Mus musculus


Alignment Length:242 Identity:57/242 - (23%)
Similarity:94/242 - (38%) Gaps:43/242 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RRVWGGVQSNTG--PNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYR-NSLEGATVEG 99
            :||.||..:|.|  |    |.:.|.:|. ...||..|.....::|:|:|:.|.| :|.:    ..
Mouse   359 KRVIGGKPANVGDYP----WQVAIKDGQ-RITCGGIYIGGCWILTAAHCVRPSRAHSYQ----VW 414

  Fly   100 TAFSECDREN-YADIDTIQ---FPEKFIYQKLYMDVAVVRLR---DPVRGRLTEFIRLC----SV 153
            ||..:..:.| ...|.|::   ..||:.......|:|::.::   ......|...:..|    ..
Mouse   415 TALLDWLKPNSQLGIQTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECELPNSVPACVPWSPY 479

  Fly   154 KVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICA-RQPKNPKQ 217
            ..||..:.::.|||......::.|.....|.:    |..|.|.:..........|| .:..:...
Mouse   480 LFQPNDRCIISGWGRGKDNQKVYSLRWGEVDL----IGNCSQFYPDRYYEKEMQCAGTRDGSIDA 540

  Fly   218 CLYDGGSPLIYGRELC----------GVVSFGSHCIDTSRPGMYTNI 254
            |..|.|.||:     |          |:||:|.:|.....||:||.:
Mouse   541 CKGDSGGPLV-----CEDINNVTYVWGIVSWGENCGKPEFPGVYTRV 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 57/241 (24%)
Tryp_SPc 55..261 CDD:304450 50/223 (22%)
CfiNP_031712.2 FIMAC 46..111 CDD:214493
SR 117..220 CDD:214555
SRCR 122..219 CDD:278931
LDLa 232..261 CDD:238060
LDLa 264..298 CDD:294076
Tryp_SPc 360..589 CDD:214473 57/241 (24%)
Tryp_SPc 361..592 CDD:238113 56/240 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.