DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and Ctrl

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:240 Identity:55/240 - (22%)
Similarity:105/240 - (43%) Gaps:26/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RRVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANC-IYPYRNSLEGATVEGTA 101
            :|:..|  .|..|....|.:.:.:..|...||.:..||..|:|:|:| :.|.|:.:        .
  Rat    32 QRIVNG--ENAVPGSWPWQVSLQDNTGFHFCGGSLIAPNWVVTAAHCKVTPGRHFV--------I 86

  Fly   102 FSECDRENYAD-IDTIQFPEKFIY-----QKLYMDVAVVRLRDPVR--GRLTEFIRLCSVKVQPK 158
            ..|.||.:.|: |..:...:...:     ..:..|:.:::|..|.|  .:::......|.:..|.
  Rat    87 LGEYDRSSNAEPIQVLSISKAITHPSWNPNTMNNDLTLLKLASPARYTAQVSPVCLASSNEALPA 151

  Fly   159 -MQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPKQCLYDG 222
             :..|..|||..:....:..:..:.|.:.::::.:|||.:.| :|..:.||| .......|..|.
  Rat   152 GLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGS-RITDSMICA-GGAGASSCQGDS 214

  Fly   223 GSPLIYGR----ELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITE 263
            |.||:..:    .|.|:||:|:...:...|.|||.:.:...:|.:
  Rat   215 GGPLVCQKGNTWVLIGIVSWGTENCNVQAPAMYTRVSKFNTWINQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 54/235 (23%)
Tryp_SPc 55..261 CDD:304450 50/219 (23%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 54/235 (23%)
Tryp_SPc 34..260 CDD:238113 54/238 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.