DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and F11

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_082342.1 Gene:F11 / 109821 MGIID:99481 Length:624 Species:Mus musculus


Alignment Length:254 Identity:63/254 - (24%)
Similarity:111/254 - (43%) Gaps:42/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVWGGVQSNTG--PNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCI----YPYRNSLEGATV 97
            ||.||..|..|  |    |.:.:....|:. ||.:......::|:|:|.    .|.:..:.|..|
Mouse   389 RVVGGAASVHGEWP----WQVTLHISQGHL-CGGSIIGNQWILTAAHCFSGIETPKKLRVYGGIV 448

  Fly    98 ------EGTAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQ 156
                  |||||..        :..:...:::...:...|:|:::|...:  ..|:|.|...:..:
Mouse   449 NQSEINEGTAFFR--------VQEMIIHDQYTTAESGYDIALLKLESAM--NYTDFQRPICLPSK 503

  Fly   157 PKMQMV-----VFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPK 216
            .....|     |.|||:.....|:.|: .:...|.::|.:||:.:::..||.:..|||...:..|
Mouse   504 GDRNAVHTECWVTGWGYTALRGEVQST-LQKAKVPLVSNEECQTRYRRHKITNKMICAGYKEGGK 567

  Fly   217 Q-CLYDGGSPL------IYGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITETEESI 268
            . |..|.|.||      ::  .|.|:.|:|..|....|||:|||:.:...:|.|..:::
Mouse   568 DTCKGDSGGPLSCKYNGVW--HLVGITSWGEGCGQKERPGVYTNVAKYVDWILEKTQTV 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 61/245 (25%)
Tryp_SPc 55..261 CDD:304450 54/227 (24%)
F11NP_082342.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..376 CDD:128519
Tryp_SPc 389..617 CDD:214473 61/245 (25%)
Tryp_SPc 390..617 CDD:238113 60/244 (25%)
Heparin-binding. /evidence=ECO:0000250 547..550 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.