DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and prss56

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:270 Identity:67/270 - (24%)
Similarity:98/270 - (36%) Gaps:44/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PKFRRVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEG 99
            ||.|.|.|.:   |.|....||:.| ..:|...||......:.::|:|:|.....|.:....|.|
 Frog    71 PKGRIVGGSI---TSPGSWPWLVNI-RFNGELMCGGVLLDDMWILTAAHCFTGSVNEVLWTVVVG 131

  Fly   100 --TAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEFIR-LCSVKV----QP 157
              ........|....::.|....||..:....|:|::.|...|..  ::..| :|...|    .|
 Frog   132 QYDLTKNAQGEKTFQVNRIVTHPKFNQKTFDNDLALLELTSSVTA--SQSARPVCLPPVPRDPTP 194

  Fly   158 KMQMVVFGWGFDNTEVEIPSSDP-RNVTVTIISIKECRQKFKSPKIASTSICARQPKNP-KQCLY 220
            .....:.|||  :...:.|.||. ....|.::|.:.||.......:.||..||...... ..|..
 Frog   195 GTNCYIAGWG--SLYEDGPLSDVIMEARVPVLSQEACRSTLGKNMLTSTMFCAGYLNGGIDSCQG 257

  Fly   221 DGGSPLI--------YGRELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITETEESINAGDVFRST 277
            |.|.||.        |  .|.|:.|:|..|.:..:||:||   ||..|.......:|        
 Frog   258 DSGGPLTCQDPISKQY--VLYGITSWGDGCGERGKPGVYT---RVTAFTDWISHQMN-------- 309

  Fly   278 KVVKETKKPP 287
                  |.||
 Frog   310 ------KSPP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 59/238 (25%)
Tryp_SPc 55..261 CDD:304450 55/222 (25%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 60/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.