DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34129 and plaua

DIOPT Version :9

Sequence 1:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:266 Identity:61/266 - (22%)
Similarity:108/266 - (40%) Gaps:65/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAYYAPLLVITSANCIYPYRNSLE----GATVEG 99
            ::.||::|.....  .|:..|..||| |.||.....|..|:|:|:| :|.....:    ...:..
Zfish   163 KIIGGLRSTVESQ--PWMAAIFKGDG-FICGGTLITPCWVLTAAHC-FPTGKRTQINRYSVVLGK 223

  Fly   100 TAFSECD--RENYADIDTIQFPEKFIY--QKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQ---- 156
            .|.:|.|  :|....:..:...|.|.|  :....|:|::::.| ..|:       |:||.:    
Zfish   224 NAINETDPVKEQKFTVSRLVIHEDFDYSTENYTHDIALLKIED-CNGQ-------CAVKTKTVRT 280

  Fly   157 ----PKMQMV-------VFGWG------------FDNTEVEIPSSDPRNVTVTIISIKEC-RQKF 197
                |..||:       :.|:|            ...|||:            :||.|.| |..:
Zfish   281 ACLPPFQQMLPVGFYCEIAGYGRYQKGTFKFSRYLKQTEVK------------LISQKVCQRTYY 333

  Fly   198 KSPKIASTSICAR-QPKNPKQCLYDGGSPLIYGRE----LCGVVSFGSHCIDTSRPGMYTNIRRV 257
            ...::....:||. :......|..|.|.||:....    |.|::|:|..|.:.::||:||.:...
Zfish   334 NKDEVNENMLCANGRDWKTDACQGDSGGPLVCEVNNIMFLFGIISWGKECAEKNQPGVYTQVSNY 398

  Fly   258 KRFITE 263
            .::|::
Zfish   399 NQWISQ 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 60/262 (23%)
Tryp_SPc 55..261 CDD:304450 57/246 (23%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.