DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6073 and AT1G14300

DIOPT Version :9

Sequence 1:NP_001247313.1 Gene:CG6073 / 43180 FlyBaseID:FBgn0039417 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001184992.1 Gene:AT1G14300 / 837991 AraportID:AT1G14300 Length:377 Species:Arabidopsis thaliana


Alignment Length:290 Identity:74/290 - (25%)
Similarity:143/290 - (49%) Gaps:30/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VKELVQFM-QPNQRLDLKAVALTHVLGLTGSSEGKSAILSLDEMLMAIFGLTFDANQTVAKDAVL 67
            ::|||:|: .|:.  .:|..|:..|.|||||.||..::....|:|:.......:.::.|::.|..
plant     5 LEELVEFLSSPSP--PVKKAAVEIVSGLTGSEEGLQSLSKYSEILLPSLSQLLNESKEVSEPAAQ 67

  Fly    68 SLINLTSEEEAAIKVFQLAKQLQPPFAIVEVAAKEITNEQSDLADPWSMVLSNLTRVESLVHEIL 132
            :|:||:.:.|.|.|:.|:        .:::||...:...:|.:.....|:|.|||:::..|..:|
plant    68 ALVNLSQKCELAKKMIQM--------GLIKVAMDMLYKPESCITRLLVMLLVNLTQLDDGVSSLL 124

  Fly   133 DTLERDDHTL--PRLAKAFAQLDYNKKKAKLHYLAPIFCNLTQVSRGRELCCHRKYELLEKLLPF 195
            ...:...|.|  .:|.::|.:........:..::..|..|:::...||:|....|..||::::  
plant   125 QIDDEKMHGLHIMKLVRSFCRSSGETADDQFEHVGSILVNISKTEDGRKLLLEPKRRLLKQII-- 187

  Fly   196 ASFEG-SVVRRGGTIGILKNVCFDTVYHDVILNEQSSILV-------AILQPLCGPEEFSDEDNE 252
            ..|:. :.:|:.|..|.::|.||:.      .|:..:||:       |:|.|:.|.:.:|::|..
plant   188 RQFDSTNQLRKKGVAGTIRNCCFEA------KNQLQNILLISEFLWPALLLPVAGSKTYSEQDVA 246

  Fly   253 LLPIEL-QYLPESKTREEDPDLRKMLLECL 281
            .:|.|| ..|...:....|||:|...||.:
plant   247 KMPPELGSALSIEREPVTDPDIRVQTLEAI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6073NP_001247313.1 DUF383 103..275 CDD:281984 43/182 (24%)
DUF384 280..337 CDD:281985 0/2 (0%)
AT1G14300NP_001184992.1 ARM 5..115 CDD:237987 33/119 (28%)
armadillo repeat 5..30 CDD:293788 8/26 (31%)
armadillo repeat 37..74 CDD:293788 7/36 (19%)
armadillo repeat 79..113 CDD:293788 8/41 (20%)
DUF383 95..270 CDD:281984 43/182 (24%)
DUF384 315..366 CDD:281985
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2973
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48742
Inparanoid 1 1.050 89 1.000 Inparanoid score I2297
OMA 1 1.010 - - QHG54604
OrthoDB 1 1.010 - - D1094436at2759
OrthoFinder 1 1.000 - - FOG0004316
OrthoInspector 1 1.000 - - oto3808
orthoMCL 1 0.900 - - OOG6_103137
Panther 1 1.100 - - LDO PTHR13387
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3587
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.