DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31086 and CG5506

DIOPT Version :9

Sequence 1:NP_001247312.1 Gene:CG31086 / 43179 FlyBaseID:FBgn0051086 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_649021.1 Gene:CG5506 / 39992 FlyBaseID:FBgn0036766 Length:180 Species:Drosophila melanogaster


Alignment Length:148 Identity:46/148 - (31%)
Similarity:68/148 - (45%) Gaps:19/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HSW----LHFSNGAIPQAAVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNKGKAYVAYANQEVEL 64
            |.|    |.:   .||..|||.|.|..|.|.::||..|.|.:|||:::...|.||........:|
  Fly    26 HVWKAGNLSY---VIPYNAVVGGFDPYGFTTYVGRVKYSNSILPARVVAETGTAYFNTETTSSKL 87

  Fly    65 ENYEVL---SGFNYEWLPAENGEVPPGAVKVGQNVDGETLYAGRGYHAGSLTVGKVHPSHGCLYI 126
            ..|::|   ...||.|:.:.:|....|||.||..|..|.::..|....|.:.:|.:..|      
  Fly    88 LVYDILVAERDVNYVWVRSFDGFYEKGAVAVGTTVKNERVFCCRAKTDGGILIGTLLLS------ 146

  Fly   127 PYDSEEVKIFAYEVLSRR 144
               |::|.|..:|.|:.|
  Fly   147 ---SQKVCIIKHESLALR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31086NP_001247312.1 DM9 3..73 CDD:128937 25/75 (33%)
DUF3421 24..134 CDD:288732 32/112 (29%)
DM9 74..143 CDD:128937 20/68 (29%)
CG5506NP_649021.1 DM9 25..96 CDD:128937 25/72 (35%)
DUF3421 47..161 CDD:288732 36/122 (30%)
DM9 100..172 CDD:128937 21/71 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.