DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31086 and CG10916

DIOPT Version :9

Sequence 1:NP_001247312.1 Gene:CG31086 / 43179 FlyBaseID:FBgn0051086 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster


Alignment Length:133 Identity:50/133 - (37%)
Similarity:78/133 - (58%) Gaps:9/133 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PQAAVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNKGKAYVAYA------NQEVELENYEVLSGF 73
            |:.||..|.:.||...::.|.:|.:|:|||..:|.|..|:.:::      ..:||:   .||:..
  Fly   124 PEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAAFGSHSCSARTLTDDVEI---LVLNDC 185

  Fly    74 NYEWLPAENGEVPPGAVKVGQNVDGETLYAGRGYHAGSLTVGKVHPSHGCLYIPYDSEEVKIFAY 138
            :|:|:|.::|..|..|:..|.:..||..|.|||.:.|.|.:|||||||..:|||:..:||.:..|
  Fly   186 DYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILRLGKVHPSHKVMYIPHHGQEVSVNTY 250

  Fly   139 EVL 141
            |||
  Fly   251 EVL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31086NP_001247312.1 DM9 3..73 CDD:128937 19/63 (30%)
DUF3421 24..134 CDD:288732 41/115 (36%)
DM9 74..143 CDD:128937 31/68 (46%)
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367
zf-rbx1 <32..74 CDD:289448
DM9 105..183 CDD:128937 18/61 (30%)
DUF3421 133..246 CDD:288732 41/115 (36%)
DM9 186..254 CDD:128937 31/68 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.